PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 291aa    MW: 33720.6 Da    PI: 5.0651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00014genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.5e-172370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+++++  G g+W++ ar+ g++Rt+k+c++rw++yl
       AA40G00014 23 KGPWTVEEDFKLINYIATNGEGRWNSLARCAGLKRTGKSCRLRWLNYL 70
                     79********************************************97 PP

2Myb_DNA-binding50.74.1e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       AA40G00014  76 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6141870IPR017930Myb domain
SuperFamilySSF466897.49E-3120117IPR009057Homeodomain-like
SMARTSM007172.5E-152272IPR001005SANT/Myb domain
PfamPF002497.7E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-222477IPR009057Homeodomain-like
CDDcd001672.56E-112570No hitNo description
PROSITE profilePS5129422.91771125IPR017930Myb domain
SMARTSM007172.9E-1475123IPR001005SANT/Myb domain
PfamPF002496.9E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2278124IPR009057Homeodomain-like
CDDcd001676.74E-796119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEGRSLKKNT NMEDIEDEID LKKGPWTVEE DFKLINYIAT NGEGRWNSLA RCAGLKRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRWSK IAQYLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSQQFKDT MKYLWMPRLV ERIQAASTTT GSVALTSQDR SINMDQLSLM  180
EPNGYITPDN SSVVISPISD STEYNSGPNP TFNPKYNSDC SKQNLVGPEM SSYDCLDYNG  240
VFNGDLTALE DQIYPNWYEN VNETPYSDSF WNIGSDQDFW LLQYQLNNGS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865745.11e-127AtMYB78
SwissprotQ9LDE11e-121MY108_ARATH; Transcription factor MYB108
TrEMBLD7MPC71e-127D7MPC7_ARALL; AtMYB78
STRINGfgenesh2_kg.8__837__AT5G49620.11e-127(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-129myb domain protein 78